SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069033|ref|YP_003155288.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069033|ref|YP_003155288.1|
Domain Number 1 Region: 659-830
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.2e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 17-214
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0057
Further Details:      
 
Domain Number 3 Region: 172-330
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0082
Further Details:      
 
Domain Number 4 Region: 533-652
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.43e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069033|ref|YP_003155288.1|
Sequence length 891
Comment assimilatory nitrite reductase (NAD(P)H) large subunit precursor [Brachybacterium faecium DSM 4810]
Sequence
MTTTGHSPLAPAAGTRMPAGTRVVVVGGGMTGHRVAARLQSQDPDGDWTLTVIGEEAHAP
YDRVHLSTWFGHRRAEMLALDPGVWADPRITLLTGDAAAGVDRAARTVTCSSGTVHEYDR
LVLATGSWAWAPRAEGRDLPGAFSYRTVDDVRALADWVAERGERLGRRVRGVVVGGGVLG
LEAAAALRDLGAHSTVVEFADRLMAVQLDDGGGEMLRLLVEDRGIEVRTGVGAAAFRPAD
DGAMGIAELTDGSELTADVVVFSTGIRPRDRLGREAGLAIADRGGIVVGESCQTSDPDIW
AIGECASFDGVCAGLIAPGNDMADVVADRFLGGTRTHHRADDGTKLKGVGVEAAAFGDVN
AMTPDALEVSFVDPVHRQYRKLVMSDDATTLLGGVFVGDISLYAQLRPLSGRPLGADPSA
VIAPEGGGDALSGAELPDDAVVCSCNNVVAGTIRRAVNEQGCHTIGALKERTTAGTVCGS
CVPTLTTLLTQELTKAGVEVSRALCEHFDHSRAELYGLVEAGGQETFTEVVAAHGTGPGR
GCAVCRPTVASILSSLGAFTGRRHNPVGRQLGSLQDTNDHVMANIQKDGTYSVIPAMPAG
EVTAEKLLVFAQVAKDHGLYVKVNGAQRIGMFGARLEQLPEIWERLVAAGFESGHAYGKS
LRMVKSCLGTNWCRYGVGDSTAMAVHLERRYRGLRSPHKIKIGVSGCARECAEAQAKDVG
VIATHRGWNLYVGGNGGAQPAHAQLLVEDLDDETLQRCIDRFLILYIREADKLQRTARWV
EQYPGGIDALRRVVVEDSLGIGEELEAAMQRHTDTYVDEWAEAVRDPERRAKFVSFINAP
DLHDSTLRYVIEREQARPARPEDDPDATFPTPCAAKEHALAGAAHLSQEDQ
Download sequence
Identical sequences C7MDP1
gi|257069033|ref|YP_003155288.1| YP_003155288.1.138 446465.Bfae_18820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]