SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069038|ref|YP_003155293.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069038|ref|YP_003155293.1|
Domain Number 1 Region: 20-322
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.68e-104
Family GatB/GatE catalytic domain-like 0.000000103
Further Details:      
 
Domain Number 2 Region: 323-428
Classification Level Classification E-value
Superfamily GatB/YqeY motif 2.49e-24
Family GatB/GatE C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069038|ref|YP_003155293.1|
Sequence length 503
Comment aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Brachybacterium faecium DSM 4810]
Sequence
MTATDIELVDYDEAVSRFDPVLGIEVHVELGTATKMFDGAPNIFAAEPNTAITPTSLGLP
GALPVVNRKAIEYAIRIGLALNCEIAENCRFARKQYFYPDLTKNFQTSQYDEPIAFDGWV
DVELEDGEIVRVEIERAHMEEDAGKNTHVGGATGRIHGATHSQVDYNRAGVPLVEIVTRP
IPDTKGRAPEVAAAYVRTLRDIFRALDVSEARMERGNVRADVNVSLRENAQAPLGTRTET
KNVNSFRSIERTVRYEISRQAGLLDAGQEIIQETRHFHEDTGGTSSGRPKSDAEDYRYFP
EPDLVPVAPSREWVEEIRSSLPELPAARRRRLLGEWGFTDLEMRDVINADALDLIEATVA
AGASAQSARKWWMGELARIAKDRDIELAELAAAPAQIAELQGLVDAKKINDKIAKQVLTK
VLDGQGDPAAIVESEGLAVVSDDSVLTGAVDQAIADNPDVVAKIQGGKVQAIGALIGPIM
KATRGQADAGRVREIIMEKLGVS
Download sequence
Identical sequences A0A1X6XKU0 C7MDP6
446465.Bfae_18870 gi|257069038|ref|YP_003155293.1| YP_003155293.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]