SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069078|ref|YP_003155333.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069078|ref|YP_003155333.1|
Domain Number 1 Region: 364-664
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.14e-62
Family Aldo-keto reductases (NADP) 0.0000898
Further Details:      
 
Domain Number 2 Region: 3-160
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.14e-46
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.002
Further Details:      
 
Domain Number 3 Region: 134-305
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.96e-34
Family Glucose 6-phosphate dehydrogenase-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069078|ref|YP_003155333.1|
Sequence length 670
Comment putative oxidoreductase, aryl-alcohol dehydrogenase like protein [Brachybacterium faecium DSM 4810]
Sequence
MSTPSSPFRWAVLGPGSIARRFASQISSSQEGVLVAVGSSSAERAQAFADEFALDGPALV
GDYEQVLASEQVDAVYIATVHTGHARLAAAALEAGKHVLCEKPLTPNAATTMALTDLAAR
SEAVLLEAYMYRFHPQTARVLELVAEGAIGEVTHVDASFAFDTGGRSGRLFDLATAGGGI
LDVGCYPMSFARFVAGAAQGSAFVDPSSITGSGTLGETGVDEWATAEVAFPGGMTASLRT
GVRLADPQSATITGSRGVIRLSDPWGLGEAQVIELDVVGEEPQRIEIPAAAAYALEADAL
AHAAREGAEVPELTGANSLGQARALDAWREQIGLRYPFEADDADIPTLTGRPLAAGSVQV
GPAMTYGSIPGVDKQVSRLVMGCDNQMTLGHASAMFDAFYEIGGTTFDTAYIYGGGYIEK
LFGQWVRNRGVREDIVVITKGAHTPYCDPESLTRQLEESLERQGTDYADLYMMHRDNPDV
PVGEFVDVMDEHLRAGRIRAYGGSNWTPERVDEANAYAKANGRTGFTILSNHFGLAEALD
VPWAGCVHATDPQSKAWLEERGIALLPWSSQARGFFTGRAHPEDRSDAELARCYYSDENF
ERLARAEELGRERGVPATAIALAFVLHQKFPTFALFGPRTIGEMRSSTLGLGVELSAQEM
AWLDLKSPTR
Download sequence
Identical sequences C7MDT6
446465.Bfae_19270 gi|257069078|ref|YP_003155333.1| YP_003155333.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]