SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069086|ref|YP_003155341.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069086|ref|YP_003155341.1|
Domain Number 1 Region: 60-332
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.47e-75
Family Alanine racemase-like, N-terminal domain 0.000000194
Further Details:      
 
Domain Number 2 Region: 305-468
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.6e-44
Family Eukaryotic ODC-like 0.00000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257069086|ref|YP_003155341.1|
Sequence length 470
Comment diaminopimelate decarboxylase [Brachybacterium faecium DSM 4810]
Sequence
MRAHEAGALHGNDAAPTWLPYPADVNTLIDGLWSRTTARNAEGAVEVGGVDVRRIAEEVG
TPAFVLDEDDFRHRARAFRDAFAEAFRPHRGADVYYAGKAFLCGAVARWVEEDGLGLDVC
TGGELAVALRAGFPASRIALHGNNKSASEIRRALEAGVGRIVIDSLDEIDQVDEIAARLG
LRAGVMLRVTTGVEAHTHEFIATAHEDQKFGLSLTGGSAFEAVHRVLDAPQLDLLGLHSH
IGSQIFDTGGFEVAARRVLQLVARVRDELGHTIDQLDLGGGFGVMYNTQHTPSTPEALAA
GIAGIVEKQCHELELDVPHLAFEPGRAIAGPSTQTLYSVGTVKDVRLGGPHHRVYVSVDG
GMSDNVRTALYDADYSCLLTGRVSEAAPEVVRVVGKHCESGDIVVKDEYLPADVRRGDLI
SVPVTGAYCYSLASNYNHVPRPPVIAVRDGEIRTLIRRETEEDLLGLDVG
Download sequence
Identical sequences C7MDU4
YP_003155341.1.138 gi|257069086|ref|YP_003155341.1| 446465.Bfae_19350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]