SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069091|ref|YP_003155346.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069091|ref|YP_003155346.1|
Domain Number 1 Region: 184-358
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-41
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 114-195
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.79e-18
Family Homodimeric domain of signal transducing histidine kinase 0.00071
Further Details:      
 
Domain Number 3 Region: 78-127
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000017
Family HAMP domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069091|ref|YP_003155346.1|
Sequence length 363
Comment histidine kinase with HAMP domain [Brachybacterium faecium DSM 4810]
Sequence
MIGAQREGDAHLRVSERLDVRPLDRFRSFKVKLGILVAASVSVAALLTQVSIRAGVEPLL
ALPLVVIAALVFTQLLARGMTSPLREMTGAARAMARGDYSRQIRTSSRDEVGQLASAFST
MASELEQTDRMRRDLVANVSHELRTPVAGLRAQLENLVDGVTEPDPAALEVALTETERLS
QLVDHLLDLSRLDAGVIDLDVEPVELTPFLHEVVDAASLASGGRDVRWIVDVDPADLWVP
ADPARLHQVIHNLLENAARHSPAGGRIHISAARTGDGAGVRIDVHDEGPGIAREDRSRVF
ERFQRGGYADASGGTGLGLAIARWAVGLHGGTIEVLDDPRSDRAHEGRSSLIRVVLPVSS
PQG
Download sequence
Identical sequences A0A1X6XX51 C7MDU9
gi|257069091|ref|YP_003155346.1| 446465.Bfae_19410 YP_003155346.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]