SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069112|ref|YP_003155367.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069112|ref|YP_003155367.1|
Domain Number 1 Region: 89-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.05e-22
Family GntR ligand-binding domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 4-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.24e-21
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069112|ref|YP_003155367.1|
Sequence length 221
Comment transcriptional regulator, GntR family [Brachybacterium faecium DSM 4810]
Sequence
MAQVRRTPLAEQAADLLLERIRGGEWALGAKLPGESTLGPQLGVGRSTVREAIRRLAGQG
VLATRQGAGVFVASLDVLEDWRTSLSTADITSVLEARIAIEVEAAALAAVRRSPAELRAI
RRAAAERAAQRSELEAHVDADLAFHRSIVAAAHNPLLLDLFDSFTPRSRQAMIDLLRRRA
EFGSDTDHAAHRAILEAVAERDGAAASAHARQHLITLLPEG
Download sequence
Identical sequences C7MDX0
gi|257069112|ref|YP_003155367.1| 446465.Bfae_19650 YP_003155367.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]