SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069115|ref|YP_003155370.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069115|ref|YP_003155370.1|
Domain Number 1 Region: 425-733
Classification Level Classification E-value
Superfamily Folate-binding domain 2.2e-78
Family Aminomethyltransferase folate-binding domain 0.000000918
Further Details:      
 
Domain Number 2 Region: 8-219,336-411
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.81e-49
Family FAD-linked reductases, N-terminal domain 0.0000153
Further Details:      
 
Domain Number 3 Region: 219-335
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000000118
Family L-aminoacid/polyamine oxidase 0.001
Further Details:      
 
Domain Number 4 Region: 764-839
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000785
Family Aminomethyltransferase beta-barrel domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069115|ref|YP_003155370.1|
Sequence length 840
Comment glycine cleavage system T protein (aminomethyltransferase) [Brachybacterium faecium DSM 4810]
Sequence
MAQLPDRADIVVVGAGVVGNAAVAHLADHGWRSIVQIDKGPLPDPGGSTGHASNFVFPVD
HSKEITDLTVDSLRQYGELGVLTRCGGIEAARSAERMQELTRRMSSARAWGVEAHLLSPA
EIHELVPHCEASLLIGGFYTPTGAIVDPLRAGELFRERARAAGALTTVAETEVTGIEVTS
GRVRRVLTDRGEIETELVLIACGVWSPQVAALAGAALPLTPAVHQMLDLGPIPALAATDD
WVSFPLLRDMDNLMYERQRGADLEIGSYAHRPLLHDPSEIPPVGNHPGQASPTSFPFTEE
DFTAQLAHARELFPRLLTDPEPPRKAALNGLLSLTPDGGALVGETPEVAGLWSAAAVWIK
EAAGVGRMVAELITEGSSEIDAHGSDIARFHPSQRTREHVRARAAEGFPKVYGISHPREQ
WLSNRPLRTSALHSRTDALGAEHYEAAGWERPQWYAANRPLLEEFGDAVDHRTHEWDARW
WSPLIEAEHLAMRERVALVDLAAFAILDVCGPGALGFLEHLAMARIDVPVGRVVYTPLLT
PAGTFRSDLTIVRRSATEFRVITGGAEGGRDLAWMRRHLPADGTVQLTDSTSALTTIGLW
GPRARDLVQPLTGQDLSDAAFGFGTGREAVIAGVPVSMLRISYVGELGWELHVAAELGPR
LWDRLWEAGQEHGVLAAGIGVYGTTGRLEKGYRLMGAELTGEYDPVEADLALPRVKRAEF
LGKQAYLASRERGPAAMLCTLALTSPPRDPAAARCPTGGEPVLSVEGDPLVDARGRRSFV
TSAGPAPSLGRYLLLAYLPPAQAVLGTRLAVEYLGQRLGAEVLTVGRTPAFDPEDSRMKG
Download sequence
Identical sequences C7MDX3
446465.Bfae_19690 YP_003155370.1.138 gi|257069115|ref|YP_003155370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]