SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069122|ref|YP_003155377.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069122|ref|YP_003155377.1|
Domain Number 1 Region: 11-391
Classification Level Classification E-value
Superfamily Cytochrome P450 4.45e-58
Family Cytochrome P450 0.000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069122|ref|YP_003155377.1|
Sequence length 392
Comment cytochrome P450 [Brachybacterium faecium DSM 4810]
Sequence
MSAPTFDPTHLEPRSATDEQRAEAPLARTPDGTWVVLGHEEAVAVAGDHESFSSAVSRFL
QVPNGLDGAEHAAFRQVLDPFFGPEPMAQLEPVVRRVAAELVEELLADVGAAGTEIDAVA
ALGAVFAVRAQTAWLGWPAQLERELLQWMVDNHEASRSGELARTAEVAERFDAIIRSVVA
PRRALGDHAPADVTTALMRVRVPLPGLPGDPGRELRDEEIVSVLRNWTGGDLGSIALCIG
VLLTGIARAPQLAERLRVGTDEEAAAIIDELLRIDDPFVANRRVATCPVTVAGHEIGAGE
RVQIHWTSANRDERVFPDPEAFDPAAHAEHNLVYGTGRHVCPGRPLATLELRVALQELLA
VADVAPAPTPGEREIAPVGGWAHAPVVLTPRG
Download sequence
Identical sequences A0A1X6XPW0 C7MDY0
446465.Bfae_19760 gi|257069122|ref|YP_003155377.1| YP_003155377.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]