SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069135|ref|YP_003155390.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069135|ref|YP_003155390.1|
Domain Number 1 Region: 146-228
Classification Level Classification E-value
Superfamily Homeodomain-like 1.6e-17
Family Tetracyclin repressor-like, N-terminal domain 0.009
Further Details:      
 
Domain Number 2 Region: 225-313
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000979
Family Tetracyclin repressor-like, C-terminal domain 0.0091
Further Details:      
 
Weak hits

Sequence:  gi|257069135|ref|YP_003155390.1|
Domain Number - Region: 16-71
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0523
Family Anti-sigma factor antagonist SpoIIaa 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069135|ref|YP_003155390.1|
Sequence length 346
Comment transcriptional regulator [Brachybacterium faecium DSM 4810]
Sequence
MPHTLSVTVHVDLDLQEVTLAVTGCLTADTHVSLLPIIAQARGLNPAPRITLDLLGTGHI
DVDGLMPLQRLIELDPDSASAPVTYRVPDPLPVCRRTVRTAPTSWAPAGSVGVDPVDGSP
LAPRHAGADVRGGAAVKAPPAPAPAGRAVRPRTRRDEILEGSAQMFAEHGYYGASLRDIS
KHIGISHPGLMHHFASKETLLDAVIDSLEAHAQRALDQAEEMSTDPKELLRALAAHWHPC
SLPVQLLTTLSAESVSGDHPGRFRMARLRRVHEHVLEQCFSELGARGLLRPGLDPAFASR
AMFGLVLNLAVREKTVRTMQNGHHDDAPIEELTRLARSFLGAELPQ
Download sequence
Identical sequences A0A1X6XQ27 C7MDZ3
446465.Bfae_19890 YP_003155390.1.138 gi|257069135|ref|YP_003155390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]