SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069159|ref|YP_003155414.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069159|ref|YP_003155414.1|
Domain Number 1 Region: 356-610
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-61
Family ABC transporter ATPase domain-like 0.0000974
Further Details:      
 
Domain Number 2 Region: 68-247
Classification Level Classification E-value
Superfamily MetI-like 1.83e-19
Family MetI-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069159|ref|YP_003155414.1|
Sequence length 621
Comment ABC-type dipeptide/oligopeptide/nickel transporter ATPase [Brachybacterium faecium DSM 4810]
Sequence
MTISTLVPRGGKVRAGLLIVLVFAALAVFGPMIARFDPSQTSFEMLEPPSARHWLGTTQT
GQDVFAQFMTGARTSLLVGLLAGVVSQVVSVAVGLLGGYLRGVADDLLYILTAVFLVIPG
MPILIVLTGYLPSRGLLSIAIVIAITSWAGSARVIRAQTLSLRNREFVEAARATGESRIR
IMFFEVLPNMLPLVASGFLFSVIGGILAEAGLAFLGLGSLTTTSWGSMLYFAQNSQALLA
GAWWWYVPPGLAIAVIGAGLALINFAIDEYSNPRLRTGAAVRKGAAARAAGGDATSTDAQ
ASGIGSTGPRRPGGATGATAEHVALTDDRAPAGTEQREDPELAPRLRPSPMPGSPIIEVD
ALHVDYPTGFGTVHAVEDVSLTLRRGEILGLAGESGSGKSTLTNAITRLLRPPAEITDGS
ITYRAEDGTATDLLHLEDRELRALRWNEIAVVFQSAMNALNPVTSIHAQFDDVIRVHRPG
LPPARRTEIAKEHLRRVGIDPSRIDAYPHELSGGMKQRVAIAIALVLEPDVIFMDEPTTA
LDLLVQRDVLDQVVRLREEYGFAIVFTTHDLALLLEISDSIAVMRHGRLVEYGPAMDVYR
SPQHPYTRTLLSSLENLGSLA
Download sequence
Identical sequences C7ME17
YP_003155414.1.138 446465.Bfae_20160 gi|257069159|ref|YP_003155414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]