SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069216|ref|YP_003155471.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069216|ref|YP_003155471.1|
Domain Number 1 Region: 22-179
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.71e-28
Family Phosphoglucomutase, first 3 domains 0.00022
Further Details:      
 
Domain Number 2 Region: 168-270
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.46e-26
Family Phosphoglucomutase, first 3 domains 0.00015
Further Details:      
 
Domain Number 3 Region: 287-383
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.1e-25
Family Phosphoglucomutase, first 3 domains 0.0015
Further Details:      
 
Domain Number 4 Region: 388-479
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000244
Family Phosphoglucomutase, C-terminal domain 0.0035
Further Details:      
 
Domain Number 5 Region: 543-589
Classification Level Classification E-value
Superfamily Trm112p-like 0.0000000209
Family Trm112p-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069216|ref|YP_003155471.1|
Sequence length 592
Comment phosphomannomutase [Brachybacterium faecium DSM 4810]
Sequence
MTDPRTPQPASGAGAHDLSGLFLANDVRGRAGEELTVEVARAVGAAFTDQLDAPALIVAH
DMRLSSPELSRAVIEGAVRRGAIVADAGLSSTDQLYCASGLHHAAGVMITASHNPGEDNG
FKLCLPGARPLGRDSGLEGIRAAAEAYLDAGEIPARGEGRSEGIDTLEDYASALRDLVPL
PEGRTVRVVVDAGNGMAGHTAPAVLGRSAQLELIDLHFTLDGSFPHHPADPLRPENLRDL
QEAVVREGADLGLAFDGDADRCVVLDERGIPVPPSAITALIAQREVARARAAGEERPAVV
ANLVSSRHVAETVREAGGEPVRSPVGHARIKQLMAEHDAVFGGEHSAHYYFRDFYFADSG
MLAALHVLSALLETEGPASALVSAHDPYAGSGEINSRVEDAAAARERVRAHAATLPAART
DDLDGLTVEHWAEELTEEDRWWFSLRSSHTEPLLRLNVEAERETTMLRIRDEILAIAQDE
DVPAQAPTTTAPTTAAPDTTASDTTASDTTAPGSTGPDAAAPAAEADAELLPAGASGADV
PGWLRSILRCPDCGGDLRDVERAMQCALCARVHPVEGGIPVLIAGRHEPPTS
Download sequence
Identical sequences C7ME74
gi|257069216|ref|YP_003155471.1| 446465.Bfae_20740 YP_003155471.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]