SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069275|ref|YP_003155530.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069275|ref|YP_003155530.1|
Domain Number 1 Region: 2-262,361-429
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.56e-74
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000945
Further Details:      
 
Domain Number 2 Region: 239-357
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000172
Further Details:      
 
Domain Number 3 Region: 453-591
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 6.67e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257069275|ref|YP_003155530.1|
Sequence length 591
Comment succinate dehydrogenase subunit A [Brachybacterium faecium DSM 4810]
Sequence
MQTHTYDVVIVGAGGAGMRAALESSKRARTAVVTKLYPTRSHTGAAQGGMCAALANVEDD
NWEWHTYDTVKGGDYLVDQDAAEVMAKEAIDAVLDLEKMGLPFNRTPEGKIDQRRFGGHT
RDHGEAPVRRSCYAADRTGHMILQTLYQNCVKQDVEFFNEYYVLDVLMTGDPRTDEGVRA
SGVVTYELATGEIHVFKAKSVVFASGGFGKIFKTTSNAHTLTGDGPAMAFRRGIPLEDME
FFQFHPTGLAGLGILLSEAARGEGGILRNSDMERFMERYAPTLKDLAPRDVVARAMANEV
REGRGAGPKKDYVYLDLTHLEPSHIDAKLPDITEFARTYLGVEPYTDPIPVFPTAHYGMG
GIPTNIRGEVLRNATDVIPGLYAAGETACVSVHGGNRLGTNSLLDINVFGRRAGIAAAEH
ADEVDMPELPEDVELPTVELLQRLRDRPATEDRIADIRLELQELMDANVQVFRTDETCRR
ALAGIAELKKRYETVAIQDKGRRYNLDLMEAVELGFLLDLAEIVALGALHRKESRGGHFR
EDFENRDDVNFLEHTMAYRTLPDEEGIEGTPIRLGTKPVVITRYEPKERTF
Download sequence
Identical sequences A0A1X6XIZ0 C7MED3
gi|257069275|ref|YP_003155530.1| YP_003155530.1.138 446465.Bfae_21330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]