SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069311|ref|YP_003155566.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069311|ref|YP_003155566.1|
Domain Number 1 Region: 127-197,224-346
Classification Level Classification E-value
Superfamily MetI-like 1.2e-16
Family MetI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069311|ref|YP_003155566.1|
Sequence length 362
Comment ABC-type dipeptide/oligopeptide/nickel transporter permease [Brachybacterium faecium DSM 4810]
Sequence
MTNSATQSSPAGVTPADETPSKGPRRVPPNLVFLGKRAGTYLVVFLVSVVLNFVLPRLMP
NDPAQSMIRDIYEKTGQRPSEYQMTIIHNMYGDPDAPIWEQFWNYLTQLAQLDLGRSIMY
YPMEVTDLIVQALPWTVYLGLISTLLGWIIGTYLGARLGWRPGRVLDSILTPFAMFFSSI
PPFWLGLLLVWYLSYSKGLFPAQGAVNQRVRPADFTNLDWVLSIAYHSILPLFCLVVVGF
TGWLFSMRNMMITTVNEDYVHLARAKGLSPERVRTAYAARNALLPNITGLAMSMGGVLMA
VVLAESVFIYPGLGGLIGASTAVRDYPLMQALLLIVIILSLVFNFIADSVYVLLDPRTRE
GS
Download sequence
Identical sequences A0A1X6X8X3 C7MEG9
446465.Bfae_21750 YP_003155566.1.138 gi|257069311|ref|YP_003155566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]