SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069321|ref|YP_003155576.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069321|ref|YP_003155576.1|
Domain Number 1 Region: 106-365
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.15e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000119
Further Details:      
 
Domain Number 2 Region: 26-112
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000000000115
Family Phenylalanyl-tRNA synthetase (PheRS) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069321|ref|YP_003155576.1|
Sequence length 368
Comment phenylalanyl-tRNA synthetase, alpha subunit [Brachybacterium faecium DSM 4810]
Sequence
MSESSSTPAAPVIDEATIGDAVDAALAAIAAAATTAELKQVRIEHVGDASVLSSANRAIK
DLPKEQKAAAGKLVGQGKGRVQKQLAARQQELAAAEEEAALAAETVDVTLPTDRRPRGAA
HPLTTLRHRIEDVFVGMGWEIAEGPEIEAEWFNFDALNFDADHPARQMQDTFYVAPEGSG
RVLRTHTSPVQARALLERGVPLYIACPGTVFRTDELDATHTPVFHQVEGLAIDKGLTMAH
LVGTLDTLAKALFGGEPVTRLRPSYFPFTEPSAEMDFRCFSCEARNGLDHEADPGCRVCG
GTGWIEMGGCGMVNPAVLRAVGVDPEEHQGFAFGLGIERILMLRNGVPDMHDIVEGDVRF
SQHYGTEI
Download sequence
Identical sequences C7MEH9
gi|257069321|ref|YP_003155576.1| 446465.Bfae_21850 YP_003155576.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]