SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069431|ref|YP_003155686.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069431|ref|YP_003155686.1|
Domain Number 1 Region: 225-406
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-18
Family Tandem AAA-ATPase domain 0.056
Further Details:      
 
Domain Number 2 Region: 11-69,102-149
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000000013
Family PIN domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069431|ref|YP_003155686.1|
Sequence length 436
Comment phoH family protein [Brachybacterium faecium DSM 4810]
Sequence
MLAEIETGVITYVLDTSVLLSDPQSLHRFAEHDIVLPIVVVTELEAKRHHPDLGYFARQA
LRILDDLRAQHGNLSRPLPIGKDGGHVHVELNHMSTASLPDGFRLGDNDTRILAVAKNLQ
HEGKNVVLVSKDLPMRIKASASGIHAEEYRAELARDRGYTGMVATTVGEQEMTDLYDGET
LSLPEIAHLPVHTGLTITSPRGSALGRITREKQVTLVPGDQTVFGVSGRSAEQRVAIDLL
QDESIGIVSLGGRAGTGKSALALCAGLEAVLERRTQRRIMVFRPLFAVGGQELGYLPGDQ
GEKMGPWGQAVFDTLGSMVSQNVIDEVLSRGMLEVLPLTHIRGRSLHDAFVIVDEAQSLE
RNVLLTMLSRIGQNSRVVLTHDVAQRDNLRIGRYDGIASVVEALKEKDLFAHVTLQRSER
SKVAELVTHVLDEPLP
Download sequence
Identical sequences C7MEU6
gi|257069431|ref|YP_003155686.1| 446465.Bfae_23030 YP_003155686.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]