SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069480|ref|YP_003155735.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069480|ref|YP_003155735.1|
Domain Number 1 Region: 48-169
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 2.22e-40
Family Insert subdomain of RNA polymerase alpha subunit 0.0000268
Further Details:      
 
Domain Number 2 Region: 14-48,170-221
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.83e-25
Family RNA polymerase alpha subunit dimerisation domain 0.0033
Further Details:      
 
Domain Number 3 Region: 247-318
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.83e-22
Family C-terminal domain of RNA polymerase alpha subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257069480|ref|YP_003155735.1|
Sequence length 331
Comment DNA-directed RNA polymerase subunit alpha [Brachybacterium faecium DSM 4810]
Sequence
MLIAQRPTLTEEVVSENRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVL
HEFSTVPGVKEDITEVILNIKNLVVSSENDEPVVMYLRREEAGRVTAADITPPAGVEIHN
PDLHIATLNEKGRLEIELIVERGRGYVSAAQNKGVDGEIGRVPVDSIYSPVLKVTYKVEA
TRVEQRTDFDKLIVDVETKPAISPRDAVASAGKTLVELFGLAHELNQEAEGIEIGPSPTD
QALAADLALPINDLNLTVRSYNCLMREGVHTVGELTARSEADLLDIRNFGQKSIDEVKAK
LADLGLSLKDSPAGFDPSALDSYSDDFGDQY
Download sequence
Identical sequences A0A1X6X718 C7MEZ5
gi|257069480|ref|YP_003155735.1| YP_003155735.1.138 446465.Bfae_23530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]