SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069536|ref|YP_003155791.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069536|ref|YP_003155791.1|
Domain Number 1 Region: 240-555
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.61e-111
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000277
Further Details:      
 
Domain Number 2 Region: 9-198
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.44e-63
Family Inosicase 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069536|ref|YP_003155791.1|
Sequence length 555
Comment IMP cyclohydrolase /phosphoribosylaminoimidazolecarboxamide formyltransferase [Brachybacterium faecium DSM 4810]
Sequence
MSTADRRPIRRALLSVFDKTGIVDLARTLAETGVEIVSTGSTGRTVREAGIPVTEVETIT
GFPEMLDGRVKTLHPRIHGGILADQRLEAHRAQLADHDIAPFDLVVVNLYPFSETVAAGG
GFDEIIEKIDVGGPTMVRAAAKNFASLAVVVDPEDYATAAEAASTGGFTLAERQELAAIA
FTRTAEYDEAISDWMLEQLSGALAEGGAAEAAAGEDDEEEEVSVLDLSEADAAELGITAT
LRYGENPHQRARLAVTDEDRPGLAGAEQLGGKEMSYNNYVDADAAVRAAFDHSLPAVAVV
KHNNPCGVAVAAEGEDIALAHRRAHGTDPLSAYGGVIAANRTVTLAMAQQVKPIFTEVIL
APGYEDDALELLRTKKNLRILRLQGEYHHPVEMREIWGGMLLQDADALDAAGDDPASWTL
AAGEAADEGTLADLAFAWRSVRAVKSNAILLAADGAAVGIGMGQVNRLDSCRLAVSRANT
LGEHAEGQDAPERARGAVAASDAFFPFADGAQILLDAGVRAIVQPGGSIRDEEVIAACQS
AGVTMYLTGTRHFSH
Download sequence
Identical sequences C7MFI4
YP_003155791.1.138 gi|257069536|ref|YP_003155791.1| 446465.Bfae_24100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]