SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069575|ref|YP_003155830.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069575|ref|YP_003155830.1|
Domain Number 1 Region: 400-478
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069575|ref|YP_003155830.1|
Sequence length 491
Comment sulfate permease-like transporter, MFS superfamily [Brachybacterium faecium DSM 4810]
Sequence
MTATPPPTSSPTTLQALRSPRLLTTEVLAGAVTTLALIPEVISFSVIAGVDPKVSLIASV
VLAISMTFLGGRPAMITAAAGAVALVVAPLVHTHGVQYLLPTVILAGLIQIAFGVLGLAR
IMRFIPRSVMIGFVNALGILIFTAQLQHVLDVPGAVYPLFALTLVVVLVLPRFTKAVPAP
LVAIILVTAIAMLAHLTVPTVGDQGEVSGGLPGITPLEVPLTLETLQLIAPTALSVAFVG
LMETLLTAKLVDDITDTRSAKGRESWALGVANILAGFWGGIAGCAMIGQTVMNVKLGRAR
TRLSTFIAGVLLLVLVTALSDLMEQIPMAALAAVMMVVAVSTVDVHSVRPATLKRMPLSE
TLVMVTTVVVVVLTNNLAIGVAAGVLLAMVLFARRVAHVITVRRSEDGALYTVRGPLFFG
SSNDLVEQFSYAEDPPQVTVDFSAAQIWDASTVAVLDSLQTKYAEHGTEVSFTGLDERSA
GFHGRLTGTLN
Download sequence
Identical sequences C7MFM3
446465.Bfae_24520 YP_003155830.1.138 gi|257069575|ref|YP_003155830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]