SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069581|ref|YP_003155836.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069581|ref|YP_003155836.1|
Domain Number 1 Region: 92-273
Classification Level Classification E-value
Superfamily MetI-like 3.92e-39
Family MetI-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257069581|ref|YP_003155836.1|
Sequence length 303
Comment ABC-type proline/glycine betaine transporter permease [Brachybacterium faecium DSM 4810]
Sequence
MTPQDDSFMPRVPVGEWADSAIDWLKANLSWLFDAFRTVMGFLVDNLTDLLLLVPALVAI
PVFALIALTLRSWKLAVGTVISFALVLSMDQWETMMQTMALVLVATAFAVLIAVPLGVLA
SLNSTVSAIVKPVMDFMQTMPAFVYLIPAVTFFSIGVVPGIFATIIFALPPGVRMTELGI
RQVDSETVEAGEAFGATPWQILRGIQLPLAIPTIMAGVNQVIMLALSMAVVAGMVGADGL
GKEVVQAISTQNLALGVEAGLSVVVLAVFLDRLTAALGNPGDYRTSLIALTQRAIAQRAT
TTV
Download sequence
Identical sequences A0A1X6Y1B7 C7MFM9
YP_003155836.1.138 446465.Bfae_24580 gi|257069581|ref|YP_003155836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]