SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069724|ref|YP_003155979.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069724|ref|YP_003155979.1|
Domain Number 1 Region: 142-373
Classification Level Classification E-value
Superfamily MetI-like 2.09e-45
Family MetI-like 0.00021
Further Details:      
 
Domain Number 2 Region: 42-137
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.000000523
Family MalF N-terminal region-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069724|ref|YP_003155979.1|
Sequence length 388
Comment permease of ABC-type sugar transporter [Brachybacterium faecium DSM 4810]
Sequence
MTAAPVTRYDDPSGPAPTEVEDAKRGSARPVRVLVGIVGMAVIAWFICNAFLAFAYFPGW
FAHSGILIGILGLVVGIGGAVVFFYFLNICIEGFPARFSAGLIPYAFLLPGFSLIGLFLL
YPTVQTIVYSFANDDSTAWVGLANYKAIFSSGHFWSTLVNNLLWILIVPVVTVAFGLAVA
VLADKLSPTGENSAKSLIFLPMAISFVGAATIWGLVYNYSAPGSAQTGLLNAIITALGGD
PQPWYQIDTARLNSMALMVILIWLQTGFAMVLISSAIKSVPEDTVEAGRVDGASEARIFW
QIIFPQVRPTLIAVLITVLILVLKVFDLIYVTTNGLYDSDVIANLFFRKLFTDQQAGQAS
AIVVVLLILVLPILVYQVKSFRQQEANR
Download sequence
Identical sequences C7MGF6
446465.Bfae_26140 gi|257069724|ref|YP_003155979.1| YP_003155979.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]