SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069782|ref|YP_003156037.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069782|ref|YP_003156037.1|
Domain Number 1 Region: 2-161
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 1.96e-28
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 184-347
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000052
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.086
Further Details:      
 
Domain Number 3 Region: 313-412
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.00000000955
Family Glutamyl tRNA-reductase dimerization domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069782|ref|YP_003156037.1|
Sequence length 500
Comment glutamyl-tRNA reductase [Brachybacterium faecium DSM 4810]
Sequence
MLAALRASHEHLDLDVLDALTRDADTLPAVLAELERERGAAGAAPVLAGEVVVSTCNRLE
IYLDTDRFHEGVDLVVDAVARTSGLDSEVVSLCFEAAMDAPVTQHLYEVTSGLRSLVLGE
AEIAGQVRQSYESARREGRTTSMLHDLFQHAFRCAKSVATQAPVGAAGRSGATVAIDRGG
IELGGYAGRSVLIVGTGAYARLGLAELMRRGAGEVRVFSPSGRAAGFAERHGIARVERSG
LEQALREADLVLACSGRGTSLFPEQFLTAGRTVVLDLALRSDLHPLVRHLKGVTVLGLED
LKLGIDAHADPALRTAHEIVGENVEAFRVQQEVRRIDPAMAALRREVFDAADGEIDRLRR
DVSGETADQLERSVRRILARVMHQPAERARHLAETGYADAYVEAFHTIFGIDISAGQELT
TGSGGSAGSDGGAAGDAPVPAGWMRVDRTVPPRGGELLEAAAEVGAQRLSTSDLARVALR
GGGCPVEHAPAADGGSGTRG
Download sequence
Identical sequences C7MGZ9
YP_003156037.1.138 446465.Bfae_26740 gi|257069782|ref|YP_003156037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]