SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069784|ref|YP_003156039.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069784|ref|YP_003156039.1|
Domain Number 1 Region: 4-335,454-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.12e-36
Family FAD-linked reductases, N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 320-437
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000049
Family L-aminoacid/polyamine oxidase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257069784|ref|YP_003156039.1|
Sequence length 487
Comment protoporphyrinogen oxidase [Brachybacterium faecium DSM 4810]
Sequence
MSTRVLVVGGGLAGLLAARRHQRAGRRVVLLEAGDAVGGAIASARLEEAGGLALNTGAEA
YSTASGAVDALVAELGLAAQVVAPREGLGSHVVSDAGVHRAPAGALLGVPGHPLAADVRA
VLGTAGALRASLERLLPASYGAREGATVAEVVGRRLGPKVLQRLVAPVVGGVHSADPATL
EFAAASPALRRGLTEHGSLVAAVHRLRGGAGQRRAGQRGGASAGTRVHALTPTMAALPET
LRAQLLDGGAILRTGVEVTGLDRAAAADTSTSTAAWTVRTSREERLEADHLVLACPPDTA
RDLLRAAAPEIAGAIPQAPSAAVRLVALVLDAPALDALPAGTGALVAPGTAGIGAKALTH
ASAKWEHVQQALREALPAAASPHLLRLSYGRPGEQLPAREGIVDLALADASRILRTPLGR
AQLRAAEVIDWDRAMRQALPGHRAALDSLDALLSQQPSLELVGSWRAGTGIDAIVRADRS
LTEGSAS
Download sequence
Identical sequences C7MH01
446465.Bfae_26760 gi|257069784|ref|YP_003156039.1| YP_003156039.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]