SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069843|ref|YP_003156098.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069843|ref|YP_003156098.1|
Domain Number 1 Region: 426-538
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.89e-26
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0004
Further Details:      
 
Domain Number 2 Region: 14-118,175-380,424-452
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.76e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069843|ref|YP_003156098.1|
Sequence length 546
Comment pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Brachybacterium faecium DSM 4810]
Sequence
MARESSSPAQSTREITADVVVLGGGPVGENLAQYAIEDSDLTAVIVESELVGGECSYYAC
MPSKALLRPLAVADTAAHLEGLSTPQLDPEALRARRDTWVSHYDDSGQVEWAEGAGMTVV
RGHGRLVGEREVLIDAAVGGHEHGPARSDAPADGADGAHGAEGVGGTDGAEGADGAARAD
GTETAHGRSATRTRIRARRAVVIATGSEAVVPGPLQALAPWTSRDATGVCEVPGELVIVG
GGVVAVEAATWMAALGARVRLLVRGTSLLTGFEPFAGKHVLDALRELGVVVELGTSVVSG
EREDARDTGLGRTHGGTVRLQVEDAAGRREVTADEVLAATGRRPALGDVGLETIGLTAED
VTGTEAATSDDATGAPLPEWLQVVGDASGEAPLTHWGKYRARVIGQAIRAGALGEPLEPV
PEQVPVPQVVFADPQVTSVGLTEEAARAAGHDVVTAQVPFGSAAGTALLRDDVTGTAQLV
VDRAAGTLLGATFVGPDASELLHGATIAITGQVPVRVLRHAVPSFPTASELWLRLLEELP
RALRQG
Download sequence
Identical sequences C7MH60
446465.Bfae_27390 YP_003156098.1.138 gi|257069843|ref|YP_003156098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]