SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069858|ref|YP_003156113.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069858|ref|YP_003156113.1|
Domain Number 1 Region: 409-573
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-41
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 2 Region: 341-412
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.46e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0034
Further Details:      
 
Domain Number 3 Region: 216-345
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000688
Family Heme-binding PAS domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069858|ref|YP_003156113.1|
Sequence length 597
Comment signal transduction histidine kinase [Brachybacterium faecium DSM 4810]
Sequence
MRGTRPADALPPSGAPPLTVRPMEEPVDAPAAWTARIGAIASPTGGTASKQLYFAAFMLG
VTLLIAISRPELVVTGLYLSALGVLAVATVLALTIRWEQLRPGWAVVVPLLDMVAVAIVR
DLMREYAVSLSLLALIPCLWLAARLRLRGVVVSVLATTALISVPTLVRAEHIDSLAIAYG
ALLPFTVLQVGLLVAGGLRLMDGQNRRLTSALREKQALLEGAAASEQLLHNIIDSVDVGL
VVVDEDGHDVLMNRAQRRVHALATAADDADPDESRLLLRYPGTTTTIPPAHRPVRRAVMQ
ETFDNFVVDIGPLGAESAVFSTSARQMLDRHGARSGAVVVFSDVTSYIETVRSQERFVAS
VSHELRTPLTSVIGYLELAQDDLALSKASAAYLQVAHRNAEQLLLIVEDLLADQVARSGT
QELTLRPRRLSEIAQQAAESFALRAEEAGIALELDLQETPELPLDAQRLQQAVGNLLSNA
LKYTGRGGRVDLRTGVHGNHAELSVADTGIGMSAQEQRNLFTQYYRTRTARESAIAGHGI
GLSLTRQIVLAHGGQISVRSQPGEGSTFTLRFSLDGADGDGAAVEDGPAIGERRAEP
Download sequence
Identical sequences C7MH75
YP_003156113.1.138 446465.Bfae_27560 gi|257069858|ref|YP_003156113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]