SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069872|ref|YP_003156127.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069872|ref|YP_003156127.1|
Domain Number 1 Region: 51-278
Classification Level Classification E-value
Superfamily MetI-like 1.1e-53
Family MetI-like 0.0000798
Further Details:      
 
Weak hits

Sequence:  gi|257069872|ref|YP_003156127.1|
Domain Number - Region: 6-40
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.00131
Family MalF N-terminal region-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069872|ref|YP_003156127.1|
Sequence length 294
Comment permease of ABC-type sugar transporter [Brachybacterium faecium DSM 4810]
Sequence
MSTDSRRRALLWIAPALIFVLVLLYLPLVQNVRLSFYNWSIFDQEMHFIGLENYRKAFTD
PFLGTAVRNNVAYAAVSLVVQVGFGLVLATLLDQFAKGRLQAFLRSVYFLPATISMTVTG
VLFTFVYDPEVGFLNAALDAVGLESLSRAWLAEPSTAMWAIIAMSQWQWTGYITALLLVA
IQRIPGEMYEAAALDGAGPVRQFFAVTVPLTREMVAILSLVTVSNALLLFNEVIVMTNGG
PNNSTQVLGTIVYQNAFVNDRMGYAATMSTLVLVLTIGLGIAQMAWTRRKRVAL
Download sequence
Identical sequences C7MHM0
YP_003156127.1.138 446465.Bfae_27710 gi|257069872|ref|YP_003156127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]