SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257070145|ref|YP_003156400.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257070145|ref|YP_003156400.1|
Domain Number 1 Region: 10-271
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 7.46e-92
Family Aldo-keto reductases (NADP) 0.0000000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257070145|ref|YP_003156400.1|
Sequence length 282
Comment aldo/keto reductase, diketogulonate reductase [Brachybacterium faecium DSM 4810]
Sequence
MTASHPDVPTIPFHDGHTIPQLGYGVFKVEPDIAADVTAQALAAGYRHIDTAKIYGNEEG
VGRAIADSGIPREELFVTTKLWNDAHAFDDAIAACEASLERLGLDHVDLYLTHWAVPSQG
QYVEAWKALIELQKRGLTRSIGVSNHPLPQLTEIIEATSVVPAIHQIELHPYFQQRELRE
AHGEHGILTQSWGPLGQGKSDLLENDAITSIAAAHDASPAQVVLAWHLAHGIVTIPKSVT
PARIVENLAAAELTLTSEEIAAIDELDRPDGRGGADPAAKTA
Download sequence
Identical sequences C7MAS3
gi|257070145|ref|YP_003156400.1| YP_003156400.1.138 446465.Bfae_30490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]