SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257070210|ref|YP_003156465.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257070210|ref|YP_003156465.1|
Domain Number 1 Region: 11-406
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-28
Family FAD-linked reductases, N-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257070210|ref|YP_003156465.1|
Sequence length 446
Comment putative flavoprotein involved in K+ transport [Brachybacterium faecium DSM 4810]
Sequence
MLTTATSSHPVVIIGAGPIGLAAAAQLSERGLSFVVLEAGSTAAAAISDWGHTRLFSPWQ
YNLDAAAQRLLEASGWIAPESDALPTGHELREQYLEPLAQLPQLAESIRYNARVTAVSRA
GMDKTRTARREETPFLVRIETADGHNEDVLASAVIDASGTWSAPNPLGQAGLLAPGELQA
LTAGHITPPLPDVQGRDRDRFTGRRVMVTGAGHSAANTLLDLAELDAATTIIWAVRTAEL
TRVYGGGDQDELAARGALGSRLRRLVDSGRIEVLTSFTITRFDVGDALTVRALTPDGERA
VDVDVLIPATGFRPDLAMLSELRHSLDPAVEAPARLGPLIDPEFHSCGSVEPHGERVLAH
PEANFYIVGMKSYGRAPTFLMATGYEQVRSIAAALAGDHEAAEAVHLDLPETGVCTTDLL
GSCDALAPAAESCCSDPELIELSAGR
Download sequence
Identical sequences C7MAY8
YP_003156465.1.138 446465.Bfae_31150 gi|257070210|ref|YP_003156465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]