SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257070218|ref|YP_003156473.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257070218|ref|YP_003156473.1|
Domain Number 1 Region: 1-273
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 3.27e-85
Family Aldo-keto reductases (NADP) 0.000000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257070218|ref|YP_003156473.1|
Sequence length 293
Comment aldo/keto reductase, diketogulonate reductase [Brachybacterium faecium DSM 4810]
Sequence
MTTTLTLNNGVRMPALGFGVFQTPPEETISAVAEALRVGYRLIDTAAAYGNEREVGEALR
RAEMDRSEVFLETKLWITDYGYDGALHGFDKSAGKLGVDQIDLLLLHQPVPTDFERTIGA
YKALETLLADGRVRAIGISNVMPDVLDRLLAETSVVPAVNQVEVHPYFTQADVQAADAEH
GILTQAWSPIGGITSYRGDSPRSTFEDPVLGEIAEAHGRTRAQVMLRWHLQQGRSAIPKS
VRPERIAENFDVAGFELTADELARIDALDTGVRGGPEPASITPETFDREIPEA
Download sequence
Identical sequences A0A1X6Y0L3 C7MAZ6
gi|257070218|ref|YP_003156473.1| 446465.Bfae_31230 YP_003156473.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]