SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257070254|ref|YP_003156509.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257070254|ref|YP_003156509.1|
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.42e-26
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 12-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000109
Family GntR-like transcriptional regulators 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257070254|ref|YP_003156509.1|
Sequence length 244
Comment transcriptional regulator, GntR family [Brachybacterium faecium DSM 4810]
Sequence
MTSTDIPLGEIQQTRSLRASVTDALRSAIILGDLEEGTLYSAPALAAPLGVSATPVREAM
MDLAREGLVTTMKNKGFRITEMTAADLEEQTQVRQLLEGPAMRALAGHVPAEELAALRDL
ADRIADAARDGDLHSYLQGDRELHARLLEHTGNRRLVDLTTRLRGQTRMRALRALADSGR
LVDSAQEHHRLLDLLAAGDGDGAFALIVRHIGHASRLWSTGDEGTGEVDSPLLDLVPLPP
DAAT
Download sequence
Identical sequences A0A1X6XND7 C7MB32
446465.Bfae_31590 YP_003156509.1.138 gi|257070254|ref|YP_003156509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]