SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257070268|ref|YP_003156523.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257070268|ref|YP_003156523.1|
Domain Number 1 Region: 59-149
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.15e-24
Family Ribosomal protein L9 C-domain 0.00052
Further Details:      
 
Domain Number 2 Region: 4-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 4.71e-16
Family Ribosomal protein L9 N-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257070268|ref|YP_003156523.1|
Sequence length 157
Comment 50S ribosomal protein L9P [Brachybacterium faecium DSM 4810]
Sequence
MTTKLILTHEVTGLGAAGDVVDVKDGYARNFLMPRGLATPWTKGGQRQLDQIRAARGKRA
IASIEEAQALKASLESKPLVLAERAGQNGRLFGAVSSKEVAEAVKEMFDKDIDRRTVEFV
TPIRSLGEHKATVRLHDDIFANLVIQVIAAKGAPAKA
Download sequence
Identical sequences A0A1X6XRK7 C7MB46
YP_003156523.1.138 gi|257070268|ref|YP_003156523.1| 446465.Bfae_31750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]