SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257070274|ref|YP_003156529.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257070274|ref|YP_003156529.1|
Domain Number 1 Region: 66-563
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 4.84e-203
Family Heme-dependent catalases 0.0000000000661
Further Details:      
 
Domain Number 2 Region: 588-732
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000000543
Family Catalase, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257070274|ref|YP_003156529.1|
Sequence length 738
Comment catalase [Brachybacterium faecium DSM 4810]
Sequence
MPLEEEPVMTSAKNTPTPAPGRPGSAPPSLEEPARPTGPLPPKPDQQGVQPRTPTGADPS
PDRSTNAQQGAHLTTSQGARLRDTDHSLKAGARGPVLLQDHHLREKITHFDHERIPERVV
HARGAAAHGVFEGYGTAEPVCRAAFLAQGRRTEVFTRFSTVVGSRGSMDTARDTRGFATK
FYTEEGTFDLVANNIPVFFIQDGIKFPDVVHAAKPHPDREIPQAQSAHDTFWDFVSLHTE
AQHHTLWFMGDRGIPRSYRMMEGFGIHTFRLTNAAGETSLVKFHWKPALGVHSLTWEEAQ
LLGGADPDFHRRDLSDAIESGAHPSWELGIQVFPDTEAQTFEGIDLLDPTKFVPEELAPV
QPVGRLTLDRNPSNYFAETEQVAFNPGHLVPGIDVTDDPLLQVRLFSYVDTQLTRLGGPN
FAQLPINRAHAPVNDMLRDGYGQQGDHAGVAPYRPNSLDGGCPFTAGEQDGAVTDLPVRV
PEGIKERALSATFEDHYSQARLFWRSMTPVEQDHIVDAYSFELGKCYEATIRQRQLQCLA
NIDGRLCARVAEALGMPAPESTVAAEDPAGQVPFSAPLSQLGGAWPVDGRTIGILVDPEA
DNSGLLDLHEAIAAASMTPVVIAPRGGEVAGVPVGRTFATAASVELDALLLAGAPRLAPD
SRPSSADGLEPRAGTLIDECWHHAKAIGAWGPGREALEARTVPGGAGLVVGDDGLEVLDG
ITELLAAHRVWERFPARA
Download sequence
Identical sequences C7MB52
gi|257070274|ref|YP_003156529.1| 446465.Bfae_31810 YP_003156529.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]