SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257070277|ref|YP_003156532.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257070277|ref|YP_003156532.1|
Domain Number 1 Region: 147-467
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 4.05e-64
Family Poly A polymerase C-terminal region-like 0.00087
Further Details:      
 
Domain Number 2 Region: 7-144
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.07e-34
Family Poly A polymerase head domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257070277|ref|YP_003156532.1|
Sequence length 471
Comment tRNA adenylyltransferase [Brachybacterium faecium DSM 4810]
Sequence
MFEALPPEIHELGRLFAAAGHELALVGGPVRDAVLGRSSADLDFTTSARPEQTETILREW
THDGAIWDMGRDFGTLGGVRDGVKVEITTYRTESYDPSSRKPQVEYGDTLVGDLSRRDFT
VNAMAVRLPSLEFVDPFDGLGDLARTLLRTPVAPGQSFSDDPLRMMRAVRFVAQLGFRIE
DATADAVEELAERITIVSAERVREELVKLMLGAHPRGGLELMTELGLAAHVLPELPALQL
EIDEHHHHKDVYQHTLTVLDQAIDLESPAGSGGPCEGPDLVLRLAALMHDVGKPATRRFE
EGGVVTFRFHETVGAKMTTRRMKALTFDKDTTKKVARLVELHLRFHGYVDSPWTDSAVRR
YVTDAGDLLQHLHRLTRADVTTRNRRKARTLARAYDELEARIDHLAEQEEIGRIRPDLDG
NRIMEVLDLPPGRTVGEAYKHLLELRMEHGPLGEERAIEELHAWWDARQER
Download sequence
Identical sequences C7MBJ0
gi|257070277|ref|YP_003156532.1| YP_003156532.1.138 446465.Bfae_31840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]