SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257068461|ref|YP_003154716.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068461|ref|YP_003154716.1|
Domain Number 1 Region: 140-279
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 2.22e-40
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00016
Further Details:      
 
Domain Number 2 Region: 16-133
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 3.28e-28
Family DHN aldolase/epimerase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068461|ref|YP_003154716.1|
Sequence length 305
Comment dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Brachybacterium faecium DSM 4810]
Sequence
MTAFPHPAGPAPARLDRIEVSGIRAWGHHGVLAAETELGQQFLADITLHLSTAPAGTADA
LSRTVNYAEVAHAVEEELRGGPHALVETLAERIAQRILTDTGHPLVRRVGVRVHKPAAPV
GLPVGDVAVSIERDAAPVEAVLALGTNLGDRARHLHDALALLAATDGIDVEWTGPVLETA
PVGGPEGQGAFLNSVIGVRTVLGPFALLEAAHRAERAARRERLVRWGPRTLDVDVITYGD
WSSRDETLTVPHPRAHERAFVLAPWHAARPGDELPGRGPIEELLAGAADRDGLRPGPDIE
GYGLP
Download sequence
Identical sequences C7MC19
YP_003154716.1.138 446465.Bfae_12830 gi|257068461|ref|YP_003154716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]