SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068600|ref|YP_003154855.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068600|ref|YP_003154855.1|
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.43e-17
Family Universal stress protein-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068600|ref|YP_003154855.1|
Sequence length 141
Comment universal stress protein UspA-like protein [Brachybacterium faecium DSM 4810]
Sequence
MTIVVGYSPSGQGRAALRAALRYAAHSAEGLAIVSHQYNDPERGMTAATEPEVRAELERA
GVECGEVTVHSSSERDIGEFLLSVVEEVAASLVVIGLRRKPPIGKLNLGASARRVVLGAP
CPVLAVKDDPSLTEDEHSTSS
Download sequence
Identical sequences A0A1X6XWW6 C7MCF8
YP_003154855.1.138 gi|257068600|ref|YP_003154855.1| 446465.Bfae_14340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]