SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068750|ref|YP_003155005.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068750|ref|YP_003155005.1|
Domain Number 1 Region: 3-281,348-364
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.22e-66
Family glucose-1-phosphate thymidylyltransferase 0.0000385
Further Details:      
 
Domain Number 2 Region: 298-411
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 9.98e-18
Family GlmU C-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068750|ref|YP_003155005.1|
Sequence length 413
Comment glucose-1-phosphate adenylyltransferase [Brachybacterium faecium DSM 4810]
Sequence
MSSHKVLAIVLAGGEGKRLMPLTLDRAKPAVPFGGIYRLIDFALSNIVNSGYLRVVVLTQ
YKSHSLDKHIAQTWRMSSLLGNYVAPVPAQQRMGKHWFRGSADAIAQSLNLISDEKPDYV
VVVGADNIYRMDFSQMLDAHIESGKSCTVAAIRQPIEMSDQFGVIETEPSDPTTIKAFVE
KPKETEGLADDPGSVLASMGNYIFTADALVEAVTRDAQDDSSKHDMGGDIVPSFVEQDDA
AVYDFIRNDVPGSTDRDRDYWRDVGTLDAFYDAHMDLISIHPVFNLYNDQWPTFTGHRNA
PPAKFVHAGPGRVGSAVDSVISPGVVVSGASVSSSVLSPGVRVNSWSTVSDSVLMDDVIV
GRHCQIHRAIIDKGVVVPPRTQIGLDAEKDLARGWVVTESGITVLGKGTVITP
Download sequence
Identical sequences C7MCV8
YP_003155005.1.138 gi|257068750|ref|YP_003155005.1| 446465.Bfae_15870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]