SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068760|ref|YP_003155015.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068760|ref|YP_003155015.1|
Domain Number 1 Region: 6-222
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9e-38
Family mannose-1-phosphate guanylyl transferase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068760|ref|YP_003155015.1|
Sequence length 251
Comment glycosyl transferase [Brachybacterium faecium DSM 4810]
Sequence
MHPSNAPLPPTLVVIPTYDEREALPGTLARLRAAVPAADVLVVDDSSPDGTGEWAEAAAA
EDPSVHVLHREGKQGLGPAYLAGFAWGLERGYRQLAEMDADASHRPEQLPRLLEAVRRGA
DLAIGSRWVPRGSVHDWPLRRLLLSRGANLYVRALLGLGVSDATAGFRLFRAELLEQLIA
EDIASQGYCFQIDMTRRSRDLGAAIAEVPIDFDERTEGTSKMSSAIVREALVKVTSWGLS
RRVQGLRKALR
Download sequence
Identical sequences C7MCW8
YP_003155015.1.138 gi|257068760|ref|YP_003155015.1| 446465.Bfae_15970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]