SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069220|ref|YP_003155475.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069220|ref|YP_003155475.1|
Domain Number 1 Region: 21-63,161-234,268-363
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000000000743
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257069220|ref|YP_003155475.1|
Sequence length 1141
Comment hypothetical protein Bfae_20780 [Brachybacterium faecium DSM 4810]
Sequence
MNDRHITAVVLLSGATTGSTLDALRQALDAQTRRPDRVVVVAPSDLPEDARGLLEEDLSA
ERIHRLLPVSASLSRAGAVRETLEALSDGPEDDTTSEAVEVLDGVEPAHGSDGPEEAEHA
EAEAASTEHAPRRRAGGRRARDVDSAAVERERTQRAEDLARIPQRLRRQRRGSGRRVGTS
AAAGESWLWFLADGAPPAADALAHQLETVEASPNTAAVGAKRVRHSDPEPAAPEHLEGAD
ALVDVGLTLTHSGRIITGVDPGEIDQGQADWRHDVLAVPLPGMLVREQTLREIGGLDPDL
PAPWAEIDLCRRIWRSGERVAVQSAARVLHPAPTRPVLDRLREQRTGQLLVLLKQRSLPH
ALLTLLLLPLETLLRMLGAIAASAPRLALMELRAAAAVLPRSRRVLGRGLRERRLARVPR
GRLAPLYVPRADALRRWLDDTWVRLFADDDRQRQIRRTTWGVAGTRHGLDDADYGRHIVW
TGVVALAGGVLGLLALRGLFGRGELVGPGLRPLPADRSDLWAAAWSSWIPGGLGEAGPGD
ALVRLLGHLPVGGQLPLEILVFAAVPLSALFAWWASGALTRAVGARLVIATVWALAPPLL
TALAAGAWPLLLVHILLPLLALAVGRAIGLPHKVSQASISAAAAAGLLLLLIGAVQPALV
VLCAAGLVLVGIAAPGRRRRLLWTLLPSLALHAPFLPTYLGHPGTVLAVAGVPPLPGTAS
TAQLLALWPVAPGVEQALTPLVGSTAAALLPLLLPVAPVALAALAAPLLPGAAGRVGRFG
LLLAALGVLAVLLARGTWTAVAGDQLTTAWPHGLLSALLLALAVGAAATFDALARREARD
GRARRLLTAAAGIVVATACAASVVGWTMLLPDQLRLDRAEGGEVPAAAADQGRTEARSRV
LVLGEQADGAVEARLVVDGGDSVIQHAALADARDVDAVLAGEPVDGDPASTALREAVTGV
LSGAPAPAEEESRAAAAQLAVAYVVVRGDLDEQSALRDTLDASTELEKVTESTHGGMWRV
IDAAPRAAVVGGEAPVPLASEVIDAQGRVPAEDAARTVVLTERFDAQWRATLDGAELEPV
EVDGWAQGFTMPAGAGGDLEVHREQPLRLLWQLLLYATTALAAVVSIPWRVRSRSVEAMY
G
Download sequence
Identical sequences C7ME78
gi|257069220|ref|YP_003155475.1| 446465.Bfae_20780 YP_003155475.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]