SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069226|ref|YP_003155481.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069226|ref|YP_003155481.1|
Domain Number 1 Region: 217-347,380-465
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.38e-23
Family Spore coat polysaccharide biosynthesis protein SpsA 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069226|ref|YP_003155481.1|
Sequence length 723
Comment putative glycosyltransferase [Brachybacterium faecium DSM 4810]
Sequence
MNVTPAPATTREAADPVEGAPQRLLQRLILPHESSPDIVPLYIEASDVRSGAIGSAFGLG
GGADRAARSTAETARAPRSTPAPVDVSELSERHAVRIPAQTMRSFGTYFNAFPASYWRRW
TPVRALRLTIRTAGSGQLIVMRSTARGTLQRQEARTVHGAGEQVFELPLTAFGDGGWYWF
DAYAGAEDLTILGAEWTADAHLARTEGTFSLSMTTMNKVAYCLENIRTIAQDPDLRSLLD
VMYVIDQGADRLSDHAEELGELQDSLGAQLEIIEQGNIGGSGGFSRGMYEAATAGTSTYV
INCDDDIVLEPESLLRMSTFADFATRPTLVGAHMFDLNNRSVLHTFGEVVDPWRIQPAVA
IPDGETGHDFAQDPLRSTPWLHRRADVDYNGWWSCLIPTETVRAIGLSLPVFIKWDDAEY
GLRAKKAGYPTVSLPGAGVWHMSWVDKDDLVGWQAYFHERNRIITALLHSPYERGGRVVK
ESQFMDIKHLISMQYYTEAGRLMAQRDVLAGPEALHPSIGTKLPEIRAMAASFDDAVAKK
DPDLYPPVHVDKPPRKGRPFTEPRRLMLPVWTAKTLAKQLLAPPRARAEENPQAAIAHLD
AKWWRLSAYDSALVSNAEGTQVSWYKRDPRQVREMLAEALSAHVALHRGWSTLSERYREA
SARITSFDAWERTFAENPAPVRERDRVGHDAGSDDAESDTAQAQVQDTAQDPAPAHGGGG
SAA
Download sequence
Identical sequences A0A1X6X2H0 C7ME84
YP_003155481.1.138 gi|257069226|ref|YP_003155481.1| 446465.Bfae_20840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]