SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069228|ref|YP_003155483.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069228|ref|YP_003155483.1|
Domain Number 1 Region: 9-233
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.31e-27
Family Spore coat polysaccharide biosynthesis protein SpsA 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069228|ref|YP_003155483.1|
Sequence length 291
Comment glycosyl transferase [Brachybacterium faecium DSM 4810]
Sequence
MTRQGPSRAQAPPFTVLMPLWRGDRPDRLELALRTATLDQQLPPDLLILTIDGPLPAELE
TVVEQVEAGAYGPARVLRHDAHRGVASALQDGLESSPHDLIARADADDICRPERFALQIP
RMDAEGLDLLGSSMREFSDRVAPGTGPLRTRPLTHEEIVRYLPHHSPFHHPSVVLRRSVA
LAVGGYRDLDLLEDYWLWERMMLGGARMGNLPEVLVDYRVDEALFARRGGWRLFSSDVRL
QRRMLLDRVTTPGGFLRNLAVRATYRFAPGWARRIGYRRFVERSDRSAGAA
Download sequence
Identical sequences C7ME86
YP_003155483.1.138 446465.Bfae_20860 gi|257069228|ref|YP_003155483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]