SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069272|ref|YP_003155527.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069272|ref|YP_003155527.1|
Domain Number 1 Region: 7-166,193-308
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.4e-53
Family mannose-1-phosphate guanylyl transferase 0.000036
Further Details:      
 
Domain Number 2 Region: 340-391
Classification Level Classification E-value
Superfamily Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain 0.0000000301
Family Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069272|ref|YP_003155527.1|
Sequence length 399
Comment mannose-1-phosphate guanylyltransferase (GDP) [Brachybacterium faecium DSM 4810]
Sequence
MPQAPFVPVIPAGGAGTRLWPLSRRARPKFLLDLTGEGRSLLQGTLARLAPLADRPPIVV
TGAAHEAAVREQLASHSGVRVVGEPSPRDSMPAIALAAALVEREDPTAVIGSFAADHLIG
DQAAFREAVRLAREAAELGYLVTLGITPTHPATGFGYIEQSAEEESPGAGAGAGAADAGA
AADAGAHALPRGVRPVARFVEKPERERAERFLTTGRFLWNAGMFVVRASVLLDELAAQIP
PLARGAREIAAAHGTPEQAEVLERVWPHLTAIAIDHALAEPLAAAGRVAVVPSSFGWDDV
GDFAALARQLRERPAPAGVEGSEDRGGGDVRVLGSAAVDAVSSRATVYGATDRHIALVGL
DGISIVDTEDALLVLADEQAQDLSALVARLERRGLGHLR
Download sequence
Identical sequences C7MED0
YP_003155527.1.138 446465.Bfae_21300 gi|257069272|ref|YP_003155527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]