SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069568|ref|YP_003155823.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069568|ref|YP_003155823.1|
Domain Number 1 Region: 214-470
Classification Level Classification E-value
Superfamily Carbon-nitrogen hydrolase 2.62e-60
Family Nitrilase 0.0023
Further Details:      
 
Domain Number 2 Region: 12-204
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.15e-23
Family Molybdenum cofactor biosynthesis protein MobA 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069568|ref|YP_003155823.1|
Sequence length 477
Comment putative amidohydrolase [Brachybacterium faecium DSM 4810]
Sequence
MSSQLPETPATVAAIILAGGASSRLGGTDKTRLPIAGATALQRVLRAAPVGRRIVVGPSG
EDGDVLAARHGARFVLEDPPRSGPLAAVARGVAEFSEGPDEATVLVLGGDMPMLRPETLA
ALAARSAETARVAALEGAEGQLQFLGAAWPVGRLRAALEAIERPEGGWADLSLRRLYAQL
REEELLTVPATGAEGADIDTPDALAQVRRAAGPRIALAQIEVSEDVRETFDIVRGAVAEA
AAEGAHLVLLPEATLTPFGTDLRAAAEQHHESFAQLVQELAETHEVVVAAGSFTPADDGR
VHNTVIVRGPGWDPHLDYRKIHLFDAFGTDESRTVAPGEELITFELEGTRFGIATCYDVR
FPEQFTSLAQRGAQAILLPLAWKEGPGKREQLQLLLRARALDATVVVLAADQSPPADHTG
SAPRGIGRSAVIGPLGLVRQELGREPGLLLVDLDLEEIEAARAELPVLRHHVELPHP
Download sequence
Identical sequences C7MFL6
gi|257069568|ref|YP_003155823.1| YP_003155823.1.138 446465.Bfae_24420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]