SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069660|ref|YP_003155915.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069660|ref|YP_003155915.1|
Domain Number 1 Region: 29-319
Classification Level Classification E-value
Superfamily MetI-like 4.19e-50
Family MetI-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257069660|ref|YP_003155915.1|
Sequence length 323
Comment carbohydrate ABC transporter membrane protein [Brachybacterium faecium DSM 4810]
Sequence
MSQTLTDEHRGDGAAGLTRRTVPLGRRARRGAAPWLLLAPGLIVLGVLLLWPMLRVLNLS
LQDYQLRNLLRGESNYVGLDNYVQVLTNPFLWKTVLPNTVGFATVCVVLTMIVGTSVALF
LNSLGTVWRSICTTAIMVAWAVPALTGTYIFVWLFDPQSGLVISSLDGLGLMEAGSYNWF
TNRWTFYGIATINVVYHGFPFIAVTMLAGLMTVPQEHYEAAAMDGATAWGRFWNVTVPTL
RPIIAVCVILSTIWDFKVFVQIYLMPGGDGTSREVMNLGVWSYTQSFAQGEYGMGSTIAV
LLTALLLVISVVYIRTLMKEEEL
Download sequence
Identical sequences A0A1X6X0H2 C7MG92
gi|257069660|ref|YP_003155915.1| 446465.Bfae_25440 YP_003155915.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]