SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069758|ref|YP_003156013.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069758|ref|YP_003156013.1|
Domain Number 1 Region: 8-229
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.5e-36
Family Spore coat polysaccharide biosynthesis protein SpsA 0.065
Further Details:      
 
Weak hits

Sequence:  gi|257069758|ref|YP_003156013.1|
Domain Number - Region: 322-392,510-595
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0915
Family Serum paraoxonase/arylesterase 1, PON1 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257069758|ref|YP_003156013.1|
Sequence length 632
Comment glycosyl transferase [Brachybacterium faecium DSM 4810]
Sequence
MQKTSETPLVSLVIPVYNAMPYLRETLDALPAQGLDDSQLEVVLVNDGSDDGSETLLAEY
ASRHANYRLIDQPNSGGPADPCNKGIAAVRGKYFFVLGADDVLTEGALGDLAAYAEKEGS
DIVLAKMAGLNGRHAPSSMFRRTVADADIVEDKLYNSLTAIKLFRTDLVAETGAHNPTHL
RVGSDQPFTLACYLVAKKISVRADRDFVLIRKREDGKNVTSSARSAWDYAQLLTANIDVI
VKFSAPGELRDGILRRPIRGALRKALHPRFLQLDEQKQEAVVAEIAAAVTPVYTEAVAAH
LGPLEQVKTRLALDGRTSLLRRLLTWEKGGGKERLTHDATGFHLDLPEDLAQEIDGELLR
GVPVTGMVRLEELAVEGAQVRLAGSARVKGCDVPPDAVQLRARKRGTEDWFDVSGSEVRE
VVRGGDRALEFRADVDAAPLEKGVWDLSVVHRYGSEELVNRLGRLRSQDIAERRHRLLDG
TGRKELGLVYFTEGFGNVSLDIGHTLLPRSGPDARVLTAVSIEPDRRLVLLAAEGADRLR
ASVHADEAATGGRTVPLVPVGEGLTALSLDGDGGPRWVKVEDGTGHVVLAIPAAVSVPHT
PGGGSMLSAAADGGKRTMRAAARRLGVRRPGR
Download sequence
Identical sequences C7MGX5
446465.Bfae_26500 gi|257069758|ref|YP_003156013.1| YP_003156013.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]