SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069863|ref|YP_003156118.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069863|ref|YP_003156118.1|
Domain Number 1 Region: 82-344
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.34e-25
Family Spore coat polysaccharide biosynthesis protein SpsA 0.032
Further Details:      
 
Domain Number 2 Region: 493-601
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.00000000523
Family Phosphorelay protein luxU 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257069863|ref|YP_003156118.1|
Sequence length 629
Comment glycosyl transferase [Brachybacterium faecium DSM 4810]
Sequence
MRTALTVGLAVLYALLAVIVFGLTGVFGGFGELWWRDAAVLLLTVVAACALTYVSLLLMT
FLREVHHPRNSPGDPDALQWHVLVPCRDEESVIAETVSAARTSFPGMHVWVIDDASEDAT
ARVVQDLMVFDDRVHLISRIAPEARTGKGDALNAAYRIVSDHVGADVQDRHRTVVGVLDA
DGFLSDNALTMLAGPEAFGEETTGAVQLEVWMKNRGDRRPRPADGRLRNAVGRVLVRMQD
LEFRTTNSAMQVLRSRTGTVGMGGNGQFTRLSVLDSLAEEHERPWGRKLCEDYELGLNIL
EQGLRTHYVREAHVSQEALPFTRRLITQRTRWAQGNMECASALPGLRRSGHLSAAGLVEI
HYFMLQPLIMMLNLVLVPLLLALGLVQDPGGFWSAATLLTLVLAGLFFLVLPYAVWGLVY
RSVSGGEVSLLGAAGLGLCNLVYVYLTYVYYARAAWRSLTGRTGWAKTRRNADGRTLAAV
PVTAALEALPLMRLEEFEELTAELEGRSDLGIDFVAGWAVMWPTRSSRLERAIAAEQPAA
IRDAIGSLRVSSAMVGAARLEQAATDLEQSLAGDDLEVCRAQLPLVIAIGRETVDLLRKE
VSVRRSLQQTARPGAPAVTEARMVTVPRR
Download sequence
Identical sequences C7MH80
gi|257069863|ref|YP_003156118.1| YP_003156118.1.138 446465.Bfae_27610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]