SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257069977|ref|YP_003156232.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257069977|ref|YP_003156232.1|
Domain Number 1 Region: 229-335
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0000000536
Family Very short patch repair (VSR) endonuclease 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257069977|ref|YP_003156232.1|
Sequence length 379
Comment hypothetical protein Bfae_28800 [Brachybacterium faecium DSM 4810]
Sequence
MRATQIPRGALLSRRRWRELGVSSDRLCGPQFETLLPGHLTPRAAPASFEEMLRVLQTEL
VPGAVLSHTTAAVLYGVPVPASADDGVGLLLRRWDVHGRHRLSLFSLRDDPDAPPRASRA
TDLPPEALELRRPHVHIRIPPGRQARAGPHVTVHRMARAETRVLRGLTLSAPREMLLELA
VTLEHDELVIAIDHLLGPRGPFGPQDRDALQETLVPLAGRRGYRALVRAVEDAREGVESP
GETRTRLLLSRAGFPEPALNLRVRVPSDARTRRLDLAYEDLRVAIEYDGDVHRSRGAWRE
DQARRDSLESMGWTFRRLTAADIRAPGRFLDALRRTFLRLGADAPAPDAWRGTAGAELSR
PRPRPAPHPRPRPRTRPRP
Download sequence
Identical sequences A0A1X6XJR3 C7MHX5
YP_003156232.1.138 446465.Bfae_28800 gi|257069977|ref|YP_003156232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]