SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|251794097|ref|YP_003008828.1| from Paenibacillus sp. JDR-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251794097|ref|YP_003008828.1|
Domain Number 1 Region: 14-241
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.33e-63
Family PP-loop ATPase 0.00033
Further Details:      
 
Domain Number 2 Region: 383-470
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.94e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 222-330
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000000288
Family MesJ substrate recognition domain-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|251794097|ref|YP_003008828.1|
Sequence length 475
Comment tRNA(Ile)-lysidine synthetase [Paenibacillus sp. JDR-2]
Sequence
METGDHKLLTDMMKYRATEQLWSKGDRIVAAVSGGPDSMALLHLLWQAARQEQLTVIAAH
VNHGFRKDASRQEAEVVRQYAEKLGVPFEMIELDMPAYIEETGINAQSAAREKRYAFLHE
TAVKYGASAIALAHHADDQAETVLMRVIRGAGLTGLAGMAPKRKEKNVELIRPLLRMNKS
DIVRYCSERDVPYCLDSSNNERYYFRNVVRLDVIPYLSQFNPQLNHSLRRIADVAGAEDD
WMELEGQRLFTSLVTLSPDECKLNAGELIGLHVALQRRLIKLILNYLSKDAEIASFDAIE
TMRLAAAPAAPSTWRYDAGSGVRCIREYSSIRWVRVLNASGTSEDSYAFSISGDSKSAFI
TAGGRALHIERLKRGEAVKPAGRSEVCFDADRLVFPLMVRNRQPGDRIQVLGLNGSKKVQ
DMFVDEKIAPSERERYPLLVDANNRLLWIPGIRRSSHAQTGHETTDFLFIRMENE
Download sequence
Identical sequences C6CRM5
gi|251794097|ref|YP_003008828.1| WP_012772063.1.29859 324057.Pjdr2_0061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]