SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|251795420|ref|YP_003010151.1| from Paenibacillus sp. JDR-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251795420|ref|YP_003010151.1|
Domain Number 1 Region: 291-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.52e-45
Family ABC transporter ATPase domain-like 0.0000417
Further Details:      
 
Domain Number 2 Region: 19-288
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.07e-26
Family DNA repair protein MutS, domain III 0.011
Further Details:      
 
Domain Number 3 Region: 712-788
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000034
Family Smr domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|251795420|ref|YP_003010151.1|
Sequence length 789
Comment MutS2 family protein [Paenibacillus sp. JDR-2]
Sequence
MDSKILSTLEFHKITNKLVHHAATSLGKSVSGQLAPVSDLEDVKHMLQTTDEAYKADRLK
GNAPFGGVVDISASLHRARIGGTLNPAELLDIAATARGARRVKKHIDNLHEDDPIPLLFQ
MTEQLSEHKPLEDAIFDCIDDQAEVMDSASPELASIRRELRSGESRIREKLEQMIRSSSV
QKMLQDSIITLRNDRYVIPVKQEYRSHFGGIVHDQSGSGATLFIEPEAIVSMNNKLRETK
AAELREIEKILQKLTARAAEHVEDLLYNQDLLGKLDFAYAKARLAHEMKATLPRMNDRGF
LKIKRGRHPLIAPDKVVPLDVELGNQFTAIIVTGPNTGGKTVSLKTVGLLSLMAMSGLFV
PADEGSQLCVFDSIYADIGDEQSIEQSLSTFSSHMTNIIRILGSMTSKSLVLLDELGAGT
DPAEGSALAIAILEHIHKLDSRIIATTHYSELKAYAYNRKGVINASMEFDVATLSPTYRL
LVGVPGRSNAFAIAERLGLSQAIIDHARGEVSEEDQRVENMIASLEEDRLSAESERNTAE
SMRREMEAQRKRHEAELERFEEQRDKMLQKAQEEAHEAVAKARREADQIIADLRKLALEE
GASVKEHKLIEAKRRLEEAAPELATKKKRSAGGGAKKPAKIGAGDEVMVYSLNQKGIVAE
IGASDATVQLGIMKMKVALDDLELIKPVAQLNKQQPKQTASLKRSKEDSLRMELDLRGAN
LEEAIIEVDRFLDESYLGGLGQVYIIHGMGTGVLRAGIQQYLRKHSLVKTYRLGKYGEGG
AGVTVAELK
Download sequence
Identical sequences C6CWK0
324057.Pjdr2_1389 gi|251795420|ref|YP_003010151.1| WP_015843011.1.29859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]