SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|251796615|ref|YP_003011346.1| from Paenibacillus sp. JDR-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251796615|ref|YP_003011346.1|
Domain Number 1 Region: 260-559
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.44e-91
Family DNA repair protein MutS, domain III 0.00000121
Further Details:      
 
Domain Number 2 Region: 562-795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-58
Family ABC transporter ATPase domain-like 0.00000189
Further Details:      
 
Domain Number 3 Region: 2-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 9.68e-42
Family DNA repair protein MutS, domain I 0.0000195
Further Details:      
 
Domain Number 4 Region: 114-272
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 4.05e-31
Family DNA repair protein MutS, domain II 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|251796615|ref|YP_003011346.1|
Sequence length 900
Comment DNA mismatch repair protein MutS [Paenibacillus sp. JDR-2]
Sequence
MAGYTPMIQQYLAIKEQAKDAFLFFRLGDFYEMFFDDAINASRELEITLTGREGGMSEKI
PMCGVPYHSAENYIARLVEKGFKVAVCEQVEDPSAAKGVVRREIVRVITPGTVMESKSLA
DKSNNFIVSVGSVSTAAIGMAACDLSTGELYATSLAFNIDTLIDEINVYQPAEIVGDENL
LAQLKEQAVWNRPVLLTSRKPMAEDKLREQFEASQLEVLNETRYRAVSLLTGYLDETQKR
SLGHVRTIRAYEPNQYMILDHYTRRNLELTETVRDRSKKGSLLWLLDRTQTSMGARLLRR
WIDKPLLNRSKIEERYEAVDALYRNLIARDDIRSELNHVYDLERLVGRVAFGSANGRDMN
ALRSSIRRTPQLVELARQAGSERLRQLVDGLDDCSDLADLIETVIVDEPPVSIREGGLIR
AGYDDYLDQLREASTNGKKWLAELERREREATGIKTIKIGFNKVFGYYLEVSKGALGLLP
EGRYERKQTLANAERFVTPELKEKERLILEAEDKMVDLEYARFIELRDHLALQLHRLQRL
AEVVAELDVYQSLATVSAERRFVRPVITDQYNLVIEEGRHPVVEAVMDGVPFINNATSLR
QEEQSMLLITGPNMAGKSTYMRQVALICIMAQIGCFVPAKTAEIPMIDRIFTRIGAADDL
IGGQSTFMVEMKDIQLMTEKATASSLVIIDELGRGTSTSEGMSIAQAVIEFVHHHIGCKA
LVSTHFHELSHLEASLPKLANACMAVQESGDHVTFLRKLIPGAASTSYGIYCARLAGLPN
SIIDRAYVLLEHLEEEASEKLPAGTAIASASMAAEAPAVPSYDVVPESGLVFKETAAAVQ
LSIFDDPAAPAVQPVQEQGRRKASPKAEQLADQLRKLDLFNMTPMQAMQWLNEMKQKLND
Download sequence
Identical sequences C6CUQ6
324057.Pjdr2_2606 WP_015844204.1.29859 gi|251796615|ref|YP_003011346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]