SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|251797424|ref|YP_003012155.1| from Paenibacillus sp. JDR-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|251797424|ref|YP_003012155.1|
Domain Number - Region: 494-544
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0523
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|251797424|ref|YP_003012155.1|
Sequence length 677
Comment flagellar biosynthesis protein FlhA [Paenibacillus sp. JDR-2]
Sequence
MKVKDIAILAGIIGIVLMMVIPIPTLLLDILLILNISIALMILLIAMNTKEALDFSIFPA
ILLVTTLFRLALNVSTTRNILSHGHAGEVVQTFGSWVGGGQIAIGFVVFLILVVVQFIVI
TKGSERVAEVAARFTLDAMPGKQMSIDADLNAGLINEQQARERRSKIEREADFYGSMDGA
SKFVKGDAIASIIILLINLIGGFIIGMAIHGDSFSDALQTYSILTIGDGLVSQIPALLIS
TAAGLIVTRAASDGNFAQDVTTQLLKYPKLLYIVAGTITLLGVFTPIGILRTVPFAALLL
FGAWRMQQSIAKQMHQEELMEEEQQIEEVRSPESVISLLQVDPIEFEFGYGLIPLADTQQ
GGDLLDRIIMIRRQCALELGLVVPVIRIRDNIQLRPNEYVIKIKGNIVARGELLLNHYLA
MSPGFEDESVIGIETTEPAFGLPALWIDEAMKERAEISGYTVVDPPSVVATHLTEIIKRH
AHELIGRQETKALVENVKESYPALIEELIPSILSIGDLQKVLAKLLREKVSIRDLVTIFE
SLADQAHYTKDPDILTEYARQALSRQITQQFTSTGNMLRVITVGPALEKKIAESVQQTDQ
GSYIALDPVATQQIYQKLNEQVSRQIQSGQHPVVLTSPTIRMYLRQIVERTMQDVPVLSY
SELEPNIEVQSVGVVNL
Download sequence
Identical sequences C6D2V2
WP_015845011.1.29859 gi|251797424|ref|YP_003012155.1| 324057.Pjdr2_3436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]