SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|251799726|ref|YP_003014457.1| from Paenibacillus sp. JDR-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251799726|ref|YP_003014457.1|
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily FlgN-like 6.93e-16
Family FlgN-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|251799726|ref|YP_003014457.1|
Sequence length 167
Comment FlgN family protein [Paenibacillus sp. JDR-2]
Sequence
MNEHIRQILITLQELLDAHKELIRHANEKTEAIRLENVEAVSLVTSREKKSVQRIVDLEQ
TRLLLVGRFTVEQGLRNMRSLKMEKLIQMVYHAEQKLELQQMWRELSAAIKELQDVNTFN
QQLIRMNLDYLQFTQDLLLGAPEDEVTYHRAVQGMNVQRASRYNLKT
Download sequence
Identical sequences C6D594
324057.Pjdr2_5765 WP_015847307.1.29859 gi|251799726|ref|YP_003014457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]